PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna15386.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 229aa    MW: 26036.1 Da    PI: 7.8781
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna15386.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.3e-161562148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+ Ed+ l d+vk+ G g W + +r+ g++R++k+c++rw++yl
  mrna15386.1-v1.0-hybrid 15 KGAWTAHEDQVLRDYVKENGEGKWGKMSRETGLKRCGKSCRLRWLNYL 62
                             79********************************************97 PP

2Myb_DNA-binding54.62.5e-1768112147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg+ T++E+el+++++k+lG++ W++Ia +++ gRt++++k++w++ 
  mrna15386.1-v1.0-hybrid  68 RGNITEDEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNST 112
                              7999******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.3191062IPR017930Myb domain
SuperFamilySSF466891.8E-2813109IPR009057Homeodomain-like
SMARTSM007174.3E-131464IPR001005SANT/Myb domain
PfamPF002492.0E-131562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-221669IPR009057Homeodomain-like
CDDcd001673.04E-91762No hitNo description
PROSITE profilePS5129427.07363117IPR017930Myb domain
SMARTSM007171.3E-1667115IPR001005SANT/Myb domain
PfamPF002492.7E-1568112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-2570116IPR009057Homeodomain-like
CDDcd001671.52E-1172113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MGRSSSRCDK EGANKGAWTA HEDQVLRDYV KENGEGKWGK MSRETGLKRC GKSCRLRWLN  60
YLRPDIKRGN ITEDEEELII RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN STLRKKQENS  120
SRRSRNERKT IKDPYLTNNE IRSTSSTRNE SAEQPFLSGV ERTESDSGDG FLPTTTGESD  180
MAWNFIMDLN AGQLSISEFL HTDFSKLCEL NTMVVDCTNG ADIGHLEL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-291411626127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9674420.0GU967442.1 Rosa rugosa putative MYB transcription factor (MYB3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004303467.11e-169PREDICTED: transcription factor WER-like
SwissprotQ9FJA27e-57TT2_ARATH; Transcription factor TT2
TrEMBLD6PT021e-154D6PT02_R
STRINGGLYMA13G16890.17e-68(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.16e-56MYB family protein